Hyd-S12-1
Protein sequence:
MGGNLALKMAGEMGEGAPAALLGVCAVSPSVDLRETVRNLGRPPNRAYQWHFVRGLRRLVERKKGLYPRLYDTRRLDRLRTVRDFDELYTAPHGGFASADDYYSHSSALPLVAGIRVPTLIIHARDDPLVPCGPLLRPGATDNPYVAKATPAHGGHVAFVSADKGRRFWAEERLADFCRLPWGPPHA
Plasmid Profile:
PCR gel charts:
M: Marker, 2000 bp; Line17: Hyd-S12-1(564 bp)
Results of Western Blot:
M:Maker; C: CK; Line7: Hyd-S12-1, 20.62kDa
Loss of Weight (rate of degradation of original membrane weight, etc.): 0.648%
Line1: CK; Line3: Hyd-S12-1;
Polyethylene film weight loss (0.01 < P < 0.05 labelled *, 0.001 < P <0.01 labelled **, P < 0.001 labelled ***, P > 0.05 indicates no statistical significance labelled ns)
Scanning Electron Microscope Image:
Fourier Diagram:
Plastic Film(Carbonyl index(CI):2.32%)
Plastic Microspheres(Carbonyl index(CI):3.50%)